PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g32910.2.p
Common NameBRADI_2g32910, LOC100824190
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MIKC_MADS
Protein Properties Length: 315aa    MW: 36070.5 Da    PI: 9.3825
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g32910.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF99.31.5e-3191141151
                       S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF   1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 
                       krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyeys+
  Bradi2g32910.2.p  91 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSN 141
                       79***********************************************95 PP

2K-box102.36.3e-341592554100
             K-box   4 ssgks.leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLr 95 
                       s++   ++e +a+++qqe+akL+ +i nLq+++R l+Ge++ ++s+++L+qLe +L+k+l kiR++Knell+++ie++q++e elq++n +Lr
  Bradi2g32910.2.p 159 SNT-GtVAEINAQHYQQESAKLRHQITNLQNSNRTLIGESMATMSHRDLKQLEGRLDKGLGKIRARKNELLCAEIEYMQRREMELQNDNLYLR 250
                       333.349999*********************************************************************************** PP

             K-box  96 kklee 100
                       +k++e
  Bradi2g32910.2.p 251 SKVAE 255
                       **986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF086391.2E-55215IPR013948DNA replication regulator Sld3
SMARTSM004328.8E-4283142IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.8883143IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.03E-3284156IPR002100Transcription factor, MADS-box
CDDcd002659.25E-4484157No hitNo description
PROSITE patternPS00350085139IPR002100Transcription factor, MADS-box
PRINTSPR004042.2E-3285105IPR002100Transcription factor, MADS-box
PfamPF003191.3E-2692139IPR002100Transcription factor, MADS-box
PRINTSPR004042.2E-32105120IPR002100Transcription factor, MADS-box
PRINTSPR004042.2E-32120141IPR002100Transcription factor, MADS-box
PfamPF014862.0E-25168253IPR002487Transcription factor, K-box
PROSITE profilePS5129714.531169259IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0090376Biological Processseed trichome differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MALLLGGEIA RFPARGRDSA RDIYSLRKPQ KERHHTREEM EHSLTFSSHL QRIVQEVAAQ  60
EQPVKESDSP GSGSGSAGAS EKMGRGRIEI KRIENTTNRQ VTFCKRRNGL LKKAYELSVL  120
CDAEVALIVF SSRGRLYEYS NNSVKATIER YKKATSDTSN TGTVAEINAQ HYQQESAKLR  180
HQITNLQNSN RTLIGESMAT MSHRDLKQLE GRLDKGLGKI RARKNELLCA EIEYMQRREM  240
ELQNDNLYLR SKVAENERGQ QQTLNMMGAA STSDQYEQNM IHCDPRNFLQ FNIMQQPQYY  300
QQQEDRKAYD SVER*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P5e-2083151169Myocyte-specific enhancer factor 2B
1tqe_Q5e-2083151169Myocyte-specific enhancer factor 2B
1tqe_R5e-2083151169Myocyte-specific enhancer factor 2B
1tqe_S5e-2083151169Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4693130.0KF469313.1 Brachypodium distachyon MADS-box transcription factor 18 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010230317.10.0PREDICTED: MADS-box transcription factor 58-like isoform X1
SwissprotQ2V0P11e-143MAD58_ORYSJ; MADS-box transcription factor 58
TrEMBLA0A0Q3G9C10.0A0A0Q3G9C1_BRADI; Uncharacterized protein
STRINGBRADI2G32910.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64937144
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.12e-99MIKC_MADS family protein
Publications ? help Back to Top
  1. Wei B, et al.
    Genome-wide analysis of the MADS-box gene family in Brachypodium distachyon.
    PLoS ONE, 2014. 9(1): p. e84781
    [PMID:24454749]